PDB entry 1wjg

View 1wjg on RCSB PDB site
Description: Crystal structure of a probable ATP binding protein from thermus themophilus HB8
Class: protein binding
Keywords: ATP BINDING PROTEIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable ATP binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wjga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wjgA (A:)
    mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
    raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
    qsqrvvaeapcpvllvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wjgA (A:)
    fktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrler
    aegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsq
    sqrvvaeapcpvllv