![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin-like protein 2 [117591] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117592] (1 PDB entry) Uniprot Q9CQM9 241-336 |
![]() | Domain d1wika1: 1wik A:8-103 [114675] Other proteins in same PDB: d1wika2, d1wika3 Structural genomics target |
PDB Entry: 1wik (more details)
SCOPe Domain Sequences for d1wika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wika1 c.47.1.1 (A:8-103) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} lkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeevrqglktfsn wptypqlyvrgdlvggldivkelkdngellpilkge
Timeline for d1wika1: