SCOPe 2.08: Domain d1wika1: 1wik A:8-103

Lineage for d1wika1 (1wik A:8-103)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin-like protein 2 [117591] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117592] (1 PDB entry)
   Uniprot Q9CQM9 241-336

8. Domain d1wika1: 1wik A:8-103 [114675]
   Other proteins in same PDB: d1wika2, d1wika3
   Structural genomics target

Details for d1wika1

PDB Entry: 1wik

PDB Description: solution structure of the picot homology 2 domain of the mouse pkc- interacting cousin of thioredoxin protein

PDB Compounds: (A:) Thioredoxin-like protein 2

SCOPe Domain Sequences for d1wika1:

Sequence; same for both SEQRES and ATOM records:

>d1wika1 c.47.1.1 (A:8-103) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
lkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeevrqglktfsn
wptypqlyvrgdlvggldivkelkdngellpilkge

Timeline for d1wika1:

• d1wika1 first appeared in SCOP 1.71, called d1wika_
  
• d1wika1 appears in SCOPe 2.07