PDB entry 1wik

View 1wik on RCSB PDB site
Description: Solution Structure of the PICOT homology 2 domain of the mouse PKC-interacting cousin of thioredoxin protein
Class: electron transport
Keywords: PICOT homology 2 domain, PICOT protein, thioredoxin like 2, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ELECTRON TRANSPORT
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-like protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2410003E11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CQM9 (7-102)
      • cloning artifact (0-6)
      • cloning artifact (103-108)
    Domains in SCOPe 2.08: d1wika1, d1wika2, d1wika3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wikA (A:)
gssgssglkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeevrq
glktfsnwptypqlyvrgdlvggldivkelkdngellpilkgesgpssg