Lineage for d1whna_ (1whn A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412075Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1412076Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1412077Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1412145Protein tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) [117903] (1 species)
  7. 1412146Species Mouse (Mus musculus) [TaxId:10090] [117904] (1 PDB entry)
    Uniprot Q9D7B1 350-464
  8. 1412147Domain d1whna_: 1whn A: [114648]
    Structural genomics target

Details for d1whna_

PDB Entry: 1whn (more details)

PDB Description: solution structure of the dsrbd from hypothetical protein bab26260
PDB Compounds: (A:) hypothetical protein RIKEN cDNA 2310016K04

SCOPe Domain Sequences for d1whna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgsgiikmairfdrrayppqitpkmcllewcrreklpqpvyetvqrtidrmfcsv
vtvaeqkyqstlwdkskklaeqtaaivclrsqglpegrlgeespslnkrkreapdqdpgg
prsgpssg

SCOPe Domain Coordinates for d1whna_:

Click to download the PDB-style file with coordinates for d1whna_.
(The format of our PDB-style files is described here.)

Timeline for d1whna_: