Lineage for d1whla_ (1whl A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537616Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1537617Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1537633Protein Cylindromatosis tumour-suppressor Cyld [82065] (1 species)
  7. 1537634Species Human (Homo sapiens) [TaxId:9606] [82066] (3 PDB entries)
    Uniprot Q9NQC7 125-206, 228-304, 460-550
  8. 1537635Domain d1whla_: 1whl A: [114646]
    Structural genomics target; 1st CAP-Gly domain

Details for d1whla_

PDB Entry: 1whl (more details)

PDB Description: solution structure of the 1st cap-gly domain in human cylindromatosis tumor suppressor cyld
PDB Compounds: (A:) Cylindromatosis tumor suppressor CYLD

SCOPe Domain Sequences for d1whla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]}
gssgssgidvgcpvkvqlrsgeekfpgvvrfrgpllaertvsgiffgvelleegrgqgft
dgvyqgkqlfqcdedcgvfvaldkleliesgpssg

SCOPe Domain Coordinates for d1whla_:

Click to download the PDB-style file with coordinates for d1whla_.
(The format of our PDB-style files is described here.)

Timeline for d1whla_: