Lineage for d1whga_ (1whg A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537616Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1537617Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1537674Protein Tubulin-specific chaperone B (SKAP1) [117160] (1 species)
  7. 1537675Species Mouse (Mus musculus) [TaxId:10090] [117161] (1 PDB entry)
    Uniprot Q9D1E6 134-233
  8. 1537676Domain d1whga_: 1whg A: [114642]
    Structural genomics target

Details for d1whga_

PDB Entry: 1whg (more details)

PDB Description: solution structure of the cap-gly domain in mouse tubulin specific chaperone b
PDB Compounds: (A:) Tubulin specific chaperone B

SCOPe Domain Sequences for d1whga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgneelraqqeaeaaqrlseekaqasaisvgsrcevrapdhslrrgtvmyvgltd
fkpgywvgvrydeplgkndgsvngkryfecqakygafvkpsavtvgdsgpssg

SCOPe Domain Coordinates for d1whga_:

Click to download the PDB-style file with coordinates for d1whga_.
(The format of our PDB-style files is described here.)

Timeline for d1whga_: