SCOPe 2.08: Domain d1wgpa1: 1wgp A:8-131

Lineage for d1wgpa1 (1wgp A:8-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Probable cyclic nucleotide-gated ion channel 6 [117323] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117324] (1 PDB entry)
   Uniprot O82226 509-632

8. Domain d1wgpa1: 1wgp A:8-131 [114619]
   Other proteins in same PDB: d1wgpa2, d1wgpa3
   Structural genomics target

Details for d1wgpa1

PDB Entry: 1wgp

PDB Description: solution structure of the cnmp-binding domain from arabidopsis thaliana cyclic nucleotide-regulated ion channel

PDB Compounds: (A:) Probable cyclic nucleotide-gated ion channel 6

SCOPe Domain Sequences for d1wgpa1:

Sequence; same for both SEQRES and ATOM records:

>d1wgpa1 b.82.3.2 (A:8-131) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vrrvplfenmderlldaicerlkpclfteksylvregdpvnemlfiirgrlesvttdggr
sgfynrsllkegdfcgdelltwaldpksgsnlpsstrtvkalteveafaliadelkfvas
qfrr

Timeline for d1wgpa1:

• d1wgpa1 first appeared in SCOP 1.71, called d1wgpa_
  
• d1wgpa1 appears in SCOPe 2.07