![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Probable cyclic nucleotide-gated ion channel 6 [117323] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117324] (1 PDB entry) Uniprot O82226 509-632 |
![]() | Domain d1wgpa1: 1wgp A:8-131 [114619] Other proteins in same PDB: d1wgpa2, d1wgpa3 Structural genomics target |
PDB Entry: 1wgp (more details)
SCOPe Domain Sequences for d1wgpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgpa1 b.82.3.2 (A:8-131) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vrrvplfenmderlldaicerlkpclfteksylvregdpvnemlfiirgrlesvttdggr sgfynrsllkegdfcgdelltwaldpksgsnlpsstrtvkalteveafaliadelkfvas qfrr
Timeline for d1wgpa1: