Lineage for d1wgpa_ (1wgp A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567656Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 567662Family b.82.3.2: cAMP-binding domain [51210] (7 proteins)
    Pfam 00027
  6. 567698Protein Probable cyclic nucleotide-gated ion channel 6 [117323] (1 species)
  7. 567699Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117324] (1 PDB entry)
  8. 567700Domain d1wgpa_: 1wgp A: [114619]
    Structural genomics target

Details for d1wgpa_

PDB Entry: 1wgp (more details)

PDB Description: solution structure of the cnmp-binding domain from arabidopsis thaliana cyclic nucleotide-regulated ion channel

SCOP Domain Sequences for d1wgpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana)}
gssgssgvrrvplfenmderlldaicerlkpclfteksylvregdpvnemlfiirgrles
vttdggrsgfynrsllkegdfcgdelltwaldpksgsnlpsstrtvkalteveafaliad
elkfvasqfrrsgpssg

SCOP Domain Coordinates for d1wgpa_:

Click to download the PDB-style file with coordinates for d1wgpa_.
(The format of our PDB-style files is described here.)

Timeline for d1wgpa_: