Lineage for d1wgna1 (1wgn A:8-57)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984834Protein Ubiquitin-associated protein 1, UBAP1 [116830] (1 species)
  7. 1984835Species Human (Homo sapiens) [TaxId:9606] [116831] (1 PDB entry)
    Uniprot Q9NZ09 381-430
  8. 1984836Domain d1wgna1: 1wgn A:8-57 [114617]
    Other proteins in same PDB: d1wgna2, d1wgna3
    Structural genomics target

Details for d1wgna1

PDB Entry: 1wgn (more details)

PDB Description: Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)
PDB Compounds: (A:) ubiquitin associated protein

SCOPe Domain Sequences for d1wgna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgna1 a.5.2.1 (A:8-57) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]}
ayselqmlspserqcvetvvnmgysyecvlramkkkgenieqildylfah

SCOPe Domain Coordinates for d1wgna1:

Click to download the PDB-style file with coordinates for d1wgna1.
(The format of our PDB-style files is described here.)

Timeline for d1wgna1: