Lineage for d1wg5a_ (1wg5 A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) 
Family d.58.7.1: Canonical RBD [54929] (32 proteins) 
Protein Heterogeneous nuclear ribonucleoprotein H' [117955] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117956] (2 PDB entries) 
Domain d1wg5a_: 1wg5 A: [114602]
Structural genomics target; 1st RBD
Details for d1wg5a_
PDB Entry: 1wg5 (more details)
PDB Description: solution structure of the first rrm domain in heterogeneous nuclear ribonucleoprotein h
SCOP Domain Sequences for d1wg5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens)}
gssgssgnspdtandgfvrlrglpfgcskeeivqffsgleivpngmtlpvdfqgrstgea
fvqfasqeiaekalkkhkerighryieifkssraevrtsgpssg
SCOP Domain Coordinates for d1wg5a_:
Click to download the PDB-style file with coordinates for d1wg5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wg5a_:
- d1wg5a_ is new in SCOP 1.71
- d1wg5a_ appears in SCOP 1.73
- d1wg5a_ appears in the current release, SCOPe 2.08, called d1wg5a1
View in 3D