Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Heterogeneous nuclear ribonucleoprotein H' [117955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117956] (2 PDB entries) Uniprot P55795 103-193; 280-369 |
Domain d1wg5a1: 1wg5 A:8-98 [114602] Other proteins in same PDB: d1wg5a2, d1wg5a3 Structural genomics target; 1st RBD |
PDB Entry: 1wg5 (more details)
SCOPe Domain Sequences for d1wg5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg5a1 d.58.7.1 (A:8-98) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} nspdtandgfvrlrglpfgcskeeivqffsgleivpngmtlpvdfqgrstgeafvqfasq eiaekalkkhkerighryieifkssraevrt
Timeline for d1wg5a1: