Lineage for d1wg5a1 (1wg5 A:8-98)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951914Protein Heterogeneous nuclear ribonucleoprotein H' [117955] (1 species)
  7. 2951915Species Human (Homo sapiens) [TaxId:9606] [117956] (2 PDB entries)
    Uniprot P55795 103-193; 280-369
  8. 2951916Domain d1wg5a1: 1wg5 A:8-98 [114602]
    Other proteins in same PDB: d1wg5a2, d1wg5a3
    Structural genomics target; 1st RBD

Details for d1wg5a1

PDB Entry: 1wg5 (more details)

PDB Description: solution structure of the first rrm domain in heterogeneous nuclear ribonucleoprotein h
PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein H

SCOPe Domain Sequences for d1wg5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg5a1 d.58.7.1 (A:8-98) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}
nspdtandgfvrlrglpfgcskeeivqffsgleivpngmtlpvdfqgrstgeafvqfasq
eiaekalkkhkerighryieifkssraevrt

SCOPe Domain Coordinates for d1wg5a1:

Click to download the PDB-style file with coordinates for d1wg5a1.
(The format of our PDB-style files is described here.)

Timeline for d1wg5a1: