Lineage for d1wg4a1 (1wg4 A:8-92)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. Protein Splicing factor, arginine/serine-rich 9 (SFRS9) [117965] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [117966] (1 PDB entry)
    Uniprot Q9D0B0 104-188
  8. Domain d1wg4a1: 1wg4 A:8-92 [114601]
    Other proteins in same PDB: d1wg4a2, d1wg4a3
    Structural genomics target

Details for d1wg4a1

PDB Entry: 1wg4 (more details)

PDB Description: Solution structure of RRM domain in protein BAB31986
PDB Compounds: (A:) HYPOTHETICAL PROTEIN (RIKEN cDNA 6030486K23)

SCOPe Domain Sequences for d1wg4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg4a1 d.58.7.1 (A:8-92) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}
gpptrrsdfrvlvsglppsgswqdlkdhmreagdvcyadvqkdgmgmveylrkedmeyal
rklddtkfrshegetsyirvypers

SCOPe Domain Coordinates for d1wg4a1 are not available.

Timeline for d1wg4a1:

Domains from same chain:
(mouse over for more information)
d1wg4a2, d1wg4a3