PDB entry 1wg4

View 1wg4 on RCSB PDB site
Description: Solution structure of RRM domain in protein BAB31986
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HYPOTHETICAL PROTEIN (RIKEN cDNA 6030486K23)
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 6030486K23
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D0B0 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.08: d1wg4a1, d1wg4a2, d1wg4a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wg4A (A:)
gssgssggpptrrsdfrvlvsglppsgswqdlkdhmreagdvcyadvqkdgmgmveylrk
edmeyalrklddtkfrshegetsyirvyperssgpssg