Lineage for d1wfqa1 (1wfq A:8-83)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789716Protein Cold shock domain protein E1 (UNR) [117198] (1 species)
  7. 2789717Species Human (Homo sapiens) [TaxId:9606] [117199] (1 PDB entry)
    Uniprot O75534 15-90
  8. 2789718Domain d1wfqa1: 1wfq A:8-83 [114589]
    Other proteins in same PDB: d1wfqa2, d1wfqa3
    Structural genomics target; 1st CSD (of 9)

Details for d1wfqa1

PDB Entry: 1wfq (more details)

PDB Description: Solution structure of the first cold-shock domain of the human KIAA0885 protein (UNR protein)
PDB Compounds: (A:) UNR protein

SCOPe Domain Sequences for d1wfqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfqa1 b.40.4.5 (A:8-83) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]}
gypngtsaalretgvieklltsygfiqcserqarlffhcsqyngnlqdlkvgddvefevs
sdrrtgkpiavklvki

SCOPe Domain Coordinates for d1wfqa1:

Click to download the PDB-style file with coordinates for d1wfqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wfqa1: