SCOPe 2.05: Domain d1weva_: 1wev A:

Lineage for d1weva_ (1wev A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein PHD finger protein 22 [118342] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118343] (1 PDB entry)
   Uniprot Q9D168 150-224

8. Domain d1weva_: 1wev A: [114566]
   Structural genomics target
   complexed with zn

Details for d1weva_

PDB Entry: 1wev

PDB Description: solution structure of phd domain in protein np_082203

PDB Compounds: (A:) RIKEN cDNA 1110020M19

SCOPe Domain Sequences for d1weva_:

Sequence; same for both SEQRES and ATOM records:

>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgaddfamemglacvvcrqmtvasgnqlvecqechnlyhqdchkpqvtdkevndp
rlvwycarctrqmkrmaqknqksgpssg

Timeline for d1weva_:

• d1weva_ first appeared in SCOP 1.71
  
• d1weva_ appears in SCOPe 2.04
  
• d1weva_ is called d1weva1 in SCOPe 2.06
  
• d1weva_ appears in the current release, SCOPe 2.08, called d1weva1