![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (14 proteins) |
![]() | Protein PHD finger protein 22 [118342] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118343] (1 PDB entry) Uniprot Q9D168 150-224 |
![]() | Domain d1weva1: 1wev A:8-82 [114566] Other proteins in same PDB: d1weva2, d1weva3 Structural genomics target complexed with zn |
PDB Entry: 1wev (more details)
SCOPe Domain Sequences for d1weva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1weva1 g.50.1.2 (A:8-82) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} addfamemglacvvcrqmtvasgnqlvecqechnlyhqdchkpqvtdkevndprlvwyca rctrqmkrmaqknqk
Timeline for d1weva1: