SCOPe 2.08: Domain d1weva1: 1wev A:8-82

Lineage for d1weva1 (1wev A:8-82)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein PHD finger protein 22 [118342] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118343] (1 PDB entry)
   Uniprot Q9D168 150-224

8. Domain d1weva1: 1wev A:8-82 [114566]
   Other proteins in same PDB: d1weva2, d1weva3
   Structural genomics target
   complexed with zn

Details for d1weva1

PDB Entry: 1wev

PDB Description: solution structure of phd domain in protein np_082203

PDB Compounds: (A:) RIKEN cDNA 1110020M19

SCOPe Domain Sequences for d1weva1:

Sequence; same for both SEQRES and ATOM records:

>d1weva1 g.50.1.2 (A:8-82) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]}
addfamemglacvvcrqmtvasgnqlvecqechnlyhqdchkpqvtdkevndprlvwyca
rctrqmkrmaqknqk

Timeline for d1weva1:

• d1weva1 first appeared in SCOP 1.71, called d1weva_
  
• d1weva1 appears in SCOPe 2.07