Lineage for d1weva1 (1wev A:8-82)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2588925Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2588946Protein PHD finger protein 22 [118342] (1 species)
  7. 2588947Species Mouse (Mus musculus) [TaxId:10090] [118343] (1 PDB entry)
    Uniprot Q9D168 150-224
  8. 2588948Domain d1weva1: 1wev A:8-82 [114566]
    Other proteins in same PDB: d1weva2, d1weva3
    Structural genomics target
    complexed with zn

Details for d1weva1

PDB Entry: 1wev (more details)

PDB Description: Solution structure of PHD domain in protein NP_082203
PDB Compounds: (A:) RIKEN cDNA 1110020M19

SCOPe Domain Sequences for d1weva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weva1 g.50.1.2 (A:8-82) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]}
addfamemglacvvcrqmtvasgnqlvecqechnlyhqdchkpqvtdkevndprlvwyca
rctrqmkrmaqknqk

SCOPe Domain Coordinates for d1weva1:

Click to download the PDB-style file with coordinates for d1weva1.
(The format of our PDB-style files is described here.)

Timeline for d1weva1: