SCOPe 2.07: Domain d1weoa1: 1weo A:8-87

Lineage for d1weoa1 (1weo A:8-87)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein Cellulose synthase A catalytic subunit 7, IRX3 [118294] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118295] (1 PDB entry)
   Uniprot Q9SWW6 26-95

8. Domain d1weoa1: 1weo A:8-87 [114561]
   Other proteins in same PDB: d1weoa2, d1weoa3
   Structural genomics target
   complexed with zn

Details for d1weoa1

PDB Entry: 1weo

PDB Description: solution structure of ring-finger in the catalytic subunit (irx3) of cellulose synthase

PDB Compounds: (A:) cellulose synthase, catalytic subunit (IRX3)

SCOPe Domain Sequences for d1weoa1:

Sequence; same for both SEQRES and ATOM records:

>d1weoa1 g.44.1.1 (A:8-87) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkplknldgqfceicgdqigltvegdlfvacnecgfpacrpcyeyerregtqncpqcktr
ykrlrgsprvegdedeedid

Timeline for d1weoa1:

• d1weoa1 first appeared in SCOP 1.71, called d1weoa_
  
• d1weoa1 appears in SCOPe 2.06
  
• d1weoa1 appears in the current release, SCOPe 2.08