Lineage for d1wdea_ (1wde A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1623746Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 1623747Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 1623748Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 1623753Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 1623754Species Aeropyrum pernix [TaxId:56636] [117735] (1 PDB entry)
    SQ Q9YDI2; APE0931
  8. 1623755Domain d1wdea_: 1wde A: [114534]
    Structural genomics target

Details for d1wdea_

PDB Entry: 1wde (more details), 2 Å

PDB Description: Crystal structure of the conserved hypothetical protein APE0931 from Aeropyrum pernix K1
PDB Compounds: (A:) Probable diphthine synthase

SCOPe Domain Sequences for d1wdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdea_ c.90.1.1 (A:) Diphthine synthase, DphB {Aeropyrum pernix [TaxId: 56636]}
eavtlllvgwgyapgmqtlealdavrradvvyvesytmpgsswlyksvveaagearvvea
srrdleersreivsraldavvavvtagdpmvatthsslaaealeagvavryipgvsgvqa
argatmlsfyrfggtvtlpgpwrgvtpisvarriylnlcaglhttalldvdergvqlspg
qgvsllleadreyareagapallarlpsvlveagaggghrvlywsslerlstadveggvy
siviparlsgveewllaaasgqrrpleydrsvyetveenckkgvymepv

SCOPe Domain Coordinates for d1wdea_:

Click to download the PDB-style file with coordinates for d1wdea_.
(The format of our PDB-style files is described here.)

Timeline for d1wdea_: