Lineage for d1wd5a_ (1wd5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863466Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1863687Protein Putative phosphoribosyltransferase TT1426 (TTHA1462) [117673] (1 species)
  7. 1863688Species Thermus thermophilus [TaxId:274] [117674] (1 PDB entry)
    Uniprot Q5SIB2
  8. 1863689Domain d1wd5a_: 1wd5 A: [114524]
    complexed with mes

Details for d1wd5a_

PDB Entry: 1wd5 (more details), 2 Å

PDB Description: Crystal structure of TT1426 from Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TT1426

SCOPe Domain Sequences for d1wd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]}
mrfrdrrhagallaealaplgleapvvlglprggvvvadevarrlggeldvvlvrkvgap
gnpefalgavgeggelvlmpyalryadqsylereaarqrdvlrkraeryrrvrpkaarkg
rdvvlvddgvatgasmeaalsvvfqegprrvvvavpvaspeaverlkaraevvalsvpqd
faavgayyldfgevtdedveaillewag

SCOPe Domain Coordinates for d1wd5a_:

Click to download the PDB-style file with coordinates for d1wd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wd5a_: