Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Putative phosphoribosyltransferase TT1426 (TTHA1462) [117673] (1 species) |
Species Thermus thermophilus [TaxId:274] [117674] (1 PDB entry) Uniprot Q5SIB2 |
Domain d1wd5a_: 1wd5 A: [114524] complexed with mes |
PDB Entry: 1wd5 (more details), 2 Å
SCOPe Domain Sequences for d1wd5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} mrfrdrrhagallaealaplgleapvvlglprggvvvadevarrlggeldvvlvrkvgap gnpefalgavgeggelvlmpyalryadqsylereaarqrdvlrkraeryrrvrpkaarkg rdvvlvddgvatgasmeaalsvvfqegprrvvvavpvaspeaverlkaraevvalsvpqd faavgayyldfgevtdedveaillewag
Timeline for d1wd5a_: