SCOP 1.75: Domain d1wcmi_: 1wcm I:

Lineage for d1wcmi_ (1wcm I:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1wcmi_: 1wcm I: [114518]

Details for d1wcmi_

PDB Entry: 1wcm, 3.8 Å

PDB Description: complete 12-subunit rna polymerase ii at 3.8 ang

PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOP Domain Sequences for d1wcmi_:

Sequence; same for both SEQRES and ATOM records:

>d1wcmi_ i.8.1.1 (I:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrhelitnigetagvvqd
igsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshiftsdqknkrtq

Timeline for d1wcmi_:

• d1wcmi_ first appeared in SCOP 1.71
  
• d1wcmi_ appears in SCOP 1.73
  
• d1wcmi_ appears in SCOPe 2.01
  
• d1wcmi_ appears in the current release, SCOPe 2.08