SCOP 1.71: Domain d1wc1b_: 1wc1 B:

Lineage for d1wc1b_ (1wc1 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam 00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylate cyclase CyaC [117982] (1 species)

7. Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)

8. Domain d1wc1b_: 1wc1 B: [114493]

Details for d1wc1b_

PDB Entry: 1wc1, 1.93 Å

PDB Description: Soluble adenylyl cyclase CyaC from S. platensis in complex with Rp- ATPalphaS

SCOP Domain Sequences for d1wc1b_:

Sequence; same for both SEQRES and ATOM records:

>d1wc1b_ d.58.29.1 (B:) Adenylate cyclase CyaC {Spirulina platensis}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm
avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk
gidepvmtcvinpnml

Timeline for d1wc1b_:

• d1wc1b_ is new in SCOP 1.71
  
• d1wc1b_ appears in SCOP 1.73
  
• d1wc1b_ appears in the current release, SCOPe 2.08