| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins) Pfam 00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
| Protein Adenylate cyclase CyaC [117982] (1 species) |
| Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries) |
| Domain d1wc1a_: 1wc1 A: [114492] |
PDB Entry: 1wc1 (more details), 1.93 Å
SCOP Domain Sequences for d1wc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wc1a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis}
lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqg
mavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflel
kgidepvmtcvinpnml
Timeline for d1wc1a_: