| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
| Protein Adenylate cyclase CyaC [117982] (1 species) |
| Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries) Uniprot O32393 1004-1200 |
| Domain d1wc0a_: 1wc0 A: [114490] complexed with apc, ca |
PDB Entry: 1wc0 (more details), 2.4 Å
SCOPe Domain Sequences for d1wc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wc0a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
shmrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgd
aimalygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgih
qgmavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikrefl
elkgidepvmtcvinpnml
Timeline for d1wc0a_: