Lineage for d1wc0b_ (1wc0 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910831Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1910832Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 1910833Protein Adenylate cyclase CyaC [117982] (1 species)
  7. 1910834Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
    Uniprot O32393 1004-1200
  8. 1910845Domain d1wc0b_: 1wc0 B: [114491]
    complexed with apc, ca

Details for d1wc0b_

PDB Entry: 1wc0 (more details), 2.4 Å

PDB Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-atp
PDB Compounds: (B:) adenylate cyclase

SCOPe Domain Sequences for d1wc0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wc0b_ d.58.29.1 (B:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
mrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqg
mavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflel
kgidepvmtcvinpnml

SCOPe Domain Coordinates for d1wc0b_:

Click to download the PDB-style file with coordinates for d1wc0b_.
(The format of our PDB-style files is described here.)

Timeline for d1wc0b_: