SCOPe 2.07: Domain d1wb8b1: 1wb8 B:4-92

Lineage for d1wb8b1 (1wb8 B:4-92)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [46616] (2 PDB entries)
   Uniprot P80857

8. Domain d1wb8b1: 1wb8 B:4-92 [114484]
   Other proteins in same PDB: d1wb8a2, d1wb8b2
   complexed with fe, pms

Details for d1wb8b1

PDB Entry: 1wb8, 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.

PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d1wb8b1:

Sequence; same for both SEQRES and ATOM records:

>d1wb8b1 a.2.11.1 (B:4-92) Fe superoxide dismutase (FeSOD) {Sulfolobus solfataricus [TaxId: 2287]}
iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
qydiqgiirgltfninghklhalywenma

Timeline for d1wb8b1:

• d1wb8b1 first appeared in SCOP 1.71
  
• d1wb8b1 appears in SCOPe 2.06
  
• d1wb8b1 appears in the current release, SCOPe 2.08