SCOPe 2.05: Domain d1wb7b2: 1wb7 B:93-208

Lineage for d1wb7b2 (1wb7 B:93-208)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [54730] (2 PDB entries)
   Uniprot P80857

8. Domain d1wb7b2: 1wb7 B:93-208 [114481]
   Other proteins in same PDB: d1wb7a1, d1wb7b1
   complexed with fe; mutant

Details for d1wb7b2

PDB Entry: 1wb7, 2.24 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.

PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d1wb7b2:

Sequence; same for both SEQRES and ATOM records:

>d1wb7b2 d.44.1.1 (B:93-208) Fe superoxide dismutase (FeSOD) {Sulfolobus solfataricus [TaxId: 2287]}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl

Timeline for d1wb7b2:

• d1wb7b2 first appeared in SCOP 1.71
  
• d1wb7b2 appears in SCOPe 2.04
  
• d1wb7b2 appears in SCOPe 2.06
  
• d1wb7b2 appears in the current release, SCOPe 2.08