![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
![]() | Species Archaeon Sulfolobus solfataricus [TaxId:2287] [54730] (2 PDB entries) |
![]() | Domain d1wb7b2: 1wb7 B:93-208 [114481] Other proteins in same PDB: d1wb7a1, d1wb7b1 complexed with fe; mutant |
PDB Entry: 1wb7 (more details), 2.24 Å
SCOP Domain Sequences for d1wb7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb7b2 d.44.1.1 (B:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus} psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl
Timeline for d1wb7b2: