Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (2 families) |
Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
Protein Hypothetical protein AF1683 [117492] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [117493] (1 PDB entry) |
Domain d1w8ia_: 1w8i A: [114368] Structural genomics target |
PDB Entry: 1w8i (more details), 2.1 Å
SCOP Domain Sequences for d1w8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8ia_ c.120.1.1 (A:) Hypothetical protein AF1683 {Archaeoglobus fulgidus [TaxId: 2234]} maalidtgiffgfyslkdvhhmdsvaivvhavegkwgrlfvtnhildetltllkykklpa dkflegfvesgvlniiytddeverkalevfkarvyekgfsytdaisevvaeelklklisy dsrfslptigrdywksldeserkrisailrekgid
Timeline for d1w8ia_: