Lineage for d1w8ia_ (1w8i A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712940Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 712941Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 712942Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 712949Protein Hypothetical protein AF1683 [117492] (1 species)
  7. 712950Species Archaeoglobus fulgidus [TaxId:2234] [117493] (1 PDB entry)
  8. 712951Domain d1w8ia_: 1w8i A: [114368]
    Structural genomics target

Details for d1w8ia_

PDB Entry: 1w8i (more details), 2.1 Å

PDB Description: the structure of gene product af1683 from archaeoglobus fulgidus.
PDB Compounds: (A:) hypothetical protein af1683

SCOP Domain Sequences for d1w8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8ia_ c.120.1.1 (A:) Hypothetical protein AF1683 {Archaeoglobus fulgidus [TaxId: 2234]}
maalidtgiffgfyslkdvhhmdsvaivvhavegkwgrlfvtnhildetltllkykklpa
dkflegfvesgvlniiytddeverkalevfkarvyekgfsytdaisevvaeelklklisy
dsrfslptigrdywksldeserkrisailrekgid

SCOP Domain Coordinates for d1w8ia_:

Click to download the PDB-style file with coordinates for d1w8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1w8ia_: