SCOP 1.73: Structural Classification of Proteins

PDB entry 1w8i

View 1w8i on RCSB PDB site
Description: the structure of gene product af1683 from archaeoglobus fulgidus.
Class: structural genomics, unknown function
Keywords: archaeoglobus fulgidus, structural genomics, hypothetical protein,psi,protein structure initiative, mcsg,midwest center for structural genomics
Deposited on 2004-09-22, released 2004-11-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: hypothetical protein af1683
Species: Archaeoglobus fulgidus
Database cross-references and differences (RAF-indexed):
- Uniprot O28590 (0-End)
Domains in SCOP 1.73: d1w8ia_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1w8iA (A:)
maalidtgiffgfyslkdvhhmdsvaivvhavegkwgrlfvtnhildetltllkykklpa
dkflegfvesgvlniiytddeverkalevfkarvyekgfsytdaisevvaeelklklisy
dsrfslptigrdywksldeserkrisailrekgidg

Sequence, based on observed residues (ATOM records): (download)

>1w8iA (A:)
maalidtgiffgfyslkdvhhmdsvaivvhavegkwgrlfvtnhildetltllkykklpa
dkflegfvesgvlniiytddeverkalevfkarvyekgfsytdaisevvaeelklklisy
dsrfslptigrdywksldeserkrisailrekgid