SCOPe 2.03: Domain d1w88h1: 1w88 H:1-192

Lineage for d1w88h1 (1w88 H:1-192)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
   automatically mapped to Pfam PF02779

6. Protein Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain [117522] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117523] (2 PDB entries)
   Uniprot P21874

8. Domain d1w88h1: 1w88 H:1-192 [114359]
   Other proteins in same PDB: d1w88a_, d1w88b2, d1w88c_, d1w88d2, d1w88e_, d1w88f2, d1w88g_, d1w88h2, d1w88i_, d1w88j_
   complexed with mg, tdp

Details for d1w88h1

PDB Entry: 1w88, 2.3 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2

PDB Compounds: (H:) pyruvate dehydrogenase e1 component, beta subunit

SCOPe Domain Sequences for d1w88h1:

Sequence, based on SEQRES records:

>d1w88h1 c.36.1.7 (H:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpegeytipi

Sequence, based on observed residues (ATOM records):

>d1w88h1 c.36.1.7 (H:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfrqevpege
ytipi

Timeline for d1w88h1:

• d1w88h1 first appeared in SCOP 1.71
  
• d1w88h1 appears in SCOPe 2.02
  
• d1w88h1 appears in SCOPe 2.04
  
• d1w88h1 appears in the current release, SCOPe 2.08