SCOPe 2.03: Domain d1w88j_: 1w88 J:

Lineage for d1w88j_ (1w88 J:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families)

5. Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)

6. Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
   Uniprot P11961 118-170
   Uniprot Q8VV74 128-169

8. Domain d1w88j_: 1w88 J: [114362]
   Other proteins in same PDB: d1w88a_, d1w88b1, d1w88b2, d1w88c_, d1w88d1, d1w88d2, d1w88e_, d1w88f1, d1w88f2, d1w88g_, d1w88h1, d1w88h2
   complexed with mg, tdp

Details for d1w88j_

PDB Entry: 1w88, 2.3 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2

PDB Compounds: (J:) dihydrolipoyllysine-residue acetyltransferase component of pyruvate

SCOPe Domain Sequences for d1w88j_:

Sequence; same for both SEQRES and ATOM records:

>d1w88j_ a.9.1.1 (J:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
rviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagg

Timeline for d1w88j_:

• d1w88j_ first appeared in SCOP 1.71
  
• d1w88j_ appears in SCOPe 2.02
  
• d1w88j_ appears in SCOPe 2.04
  
• d1w88j_ appears in the current release, SCOPe 2.08