Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) |
Protein Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain [117611] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [117612] (2 PDB entries) Uniprot P21874 |
Domain d1w85d2: 1w85 D:193-324 [114340] Other proteins in same PDB: d1w85a_, d1w85b1, d1w85c_, d1w85d1, d1w85e_, d1w85f1, d1w85g_, d1w85h1, d1w85i_, d1w85j_ complexed with k, mg, peg, tdp |
PDB Entry: 1w85 (more details), 2 Å
SCOPe Domain Sequences for d1w85d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w85d2 c.48.1.2 (D:193-324) Pyruvate dehydrogenase E1-beta, PdhB, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} gkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldietiigsvek tgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesvwlpnfk dvietakkvmnf
Timeline for d1w85d2: