SCOP 1.71: Domain d1w5fa2: 1w5f A:216-336

Lineage for d1w5fa2 (1w5f A:216-336)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Cell-division protein FtsZ [55309] (4 species)

7. Species Thermotoga maritima [TaxId:243274] [118029] (1 PDB entry)

8. Domain d1w5fa2: 1w5f A:216-336 [114248]
   Other proteins in same PDB: d1w5fa1, d1w5fb1

Details for d1w5fa2

PDB Entry: 1w5f, 2 Å

PDB Description: ftsz, t7 mutated, domain swapped (t. maritima)

SCOP Domain Sequences for d1w5fa2:

Sequence; same for both SEQRES and ATOM records:

>d1w5fa2 d.79.2.1 (A:216-336) Cell-division protein FtsZ {Thermotoga maritima}
yirltsrfariesvmkdagaailgigvgkgehrareaakkameskliehpvenassivfn
itapsnirmeevheaamiirqnssedadvkfglifddevpddeirvifiatrfpdedkil
f

Timeline for d1w5fa2:

• d1w5fa2 is new in SCOP 1.71
  
• d1w5fa2 appears in SCOP 1.73
  
• d1w5fa2 appears in the current release, SCOPe 2.08