Lineage for d1w5ct_ (1w5c T:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2270094Fold i.5: Photosystems [58155] (1 superfamily)
  4. 2270095Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 2270096Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 2270110Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 2270148Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 2270189Domain d1w5ct_: 1w5c T: [114227]
    complexed with bcr, cla, fe2, hec, hem, mn, pho, pl9

Details for d1w5ct_

PDB Entry: 1w5c (more details), 3.2 Å

PDB Description: Photosystem II from Thermosynechococcus elongatus
PDB Compounds: (T:) cytochrome c-550

SCOPe Domain Sequences for d1w5ct_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5ct_ i.5.1.1 (T:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
eltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetlal
atpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghilv
epkilgdkwgggkvyy

SCOPe Domain Coordinates for d1w5ct_:

Click to download the PDB-style file with coordinates for d1w5ct_.
(The format of our PDB-style files is described here.)

Timeline for d1w5ct_: