Lineage for d1w5ck_ (1w5c K:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1070931Fold i.5: Photosystems [58155] (1 superfamily)
  4. 1070932Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 1070933Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 1070947Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 1070985Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 1070996Domain d1w5ck_: 1w5c K: [114225]
    complexed with bcr, cl1, cla, fe2, hec, hem, mn, pho, pl9

Details for d1w5ck_

PDB Entry: 1w5c (more details), 3.2 Å

PDB Description: Photosystem II from Thermosynechococcus elongatus
PDB Compounds: (K:) cytochrome b559 alpha subunit

SCOPe Domain Sequences for d1w5ck_:

Sequence, based on SEQRES records: (download)

>d1w5ck_ i.5.1.1 (K:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
rpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvt
drfeakqqvetfleqlk

Sequence, based on observed residues (ATOM records): (download)

>d1w5ck_ i.5.1.1 (K:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
rpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvt
drfakqqvetfleqlk

SCOPe Domain Coordinates for d1w5ck_:

Click to download the PDB-style file with coordinates for d1w5ck_.
(The format of our PDB-style files is described here.)

Timeline for d1w5ck_: