Lineage for d1w5ci_ (1w5c I:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2648912Fold i.5: Photosystems [58155] (1 superfamily)
  4. 2648913Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 2648914Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 2648928Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 2648966Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 2649003Domain d1w5ci_: 1w5c I: [114223]
    complexed with bcr, cla, fe2, hec, hem, mn, pho, pl9

Details for d1w5ci_

PDB Entry: 1w5c (more details), 3.2 Å

PDB Description: Photosystem II from Thermosynechococcus elongatus
PDB Compounds: (I:) Photosystem II CP43 protein

SCOPe Domain Sequences for d1w5ci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5ci_ i.5.1.1 (I:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
ifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekp
myeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetl
eeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvit
nptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwa
rrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflir
dqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnki
kndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvg
hlwhagraraaaagfekg

SCOPe Domain Coordinates for d1w5ci_:

Click to download the PDB-style file with coordinates for d1w5ci_.
(The format of our PDB-style files is described here.)

Timeline for d1w5ci_: