Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (5 species) |
Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries) Uniprot P27958 1027-1206,1678-1669 Uniprot P26662 1029-1202,1677-1689 Uniprot O36579 1054-1207 |
Domain d1w3c.1: 1w3c A:,C: [114138] complexed with dn1, dn2 |
PDB Entry: 1w3c (more details), 2.3 Å
SCOPe Domain Sequences for d1w3c.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1w3c.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} itaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgagsk tlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrgds rgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmeXgsvvi vgriilsg
Timeline for d1w3c.1:
View in 3D Domains from other chains: (mouse over for more information) d1w3c.2, d1w3c.2, d1w3c.2, d1w3c.2 |