Lineage for d1w25b2 (1w25 B:141-293)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982189Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 982359Protein Response regulator PleD, receiver domain [117472] (1 species)
    duplication: tandem repeat of 2 CheY-like domains
  7. 982360Species Caulobacter crescentus [TaxId:155892] [117473] (2 PDB entries)
    Uniprot Q9A5I5
  8. 982368Domain d1w25b2: 1w25 B:141-293 [114094]
    Other proteins in same PDB: d1w25a3, d1w25b3
    complexed with c2e, mg, zn

Details for d1w25b2

PDB Entry: 1w25 (more details), 2.7 Å

PDB Description: response regulator pled in complex with c-digmp
PDB Compounds: (B:) stalked-cell differentiation controlling protein

SCOPe Domain Sequences for d1w25b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w25b2 c.23.1.1 (B:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}
viagaaarldglggrvlivddnerqaqrvaaelgvehrpviesdpekakisaggpvdlvi
vnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmvkaleigvndilsrpidpqe
lsarvktqiqrkrytdylrnnldhslelavtdq

SCOPe Domain Coordinates for d1w25b2:

Click to download the PDB-style file with coordinates for d1w25b2.
(The format of our PDB-style files is described here.)

Timeline for d1w25b2: