SCOPe 2.08: Domain d1w1da1: 1w1d A:409-550

Lineage for d1w1da1 (1w1d A:409-550)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries)
   Uniprot O15530 409-550

8. Domain d1w1da1: 1w1d A:409-550 [114074]
   Other proteins in same PDB: d1w1da2
   complexed with 4ip, au, gol
   has additional insertions and/or extensions that are not grouped together

Details for d1w1da1

PDB Entry: 1w1d, 1.5 Å

PDB Description: crystal structure of the pdk1 pleckstrin homology (ph) domain bound to inositol (1,3,4,5)-tetrakisphosphate

PDB Compounds: (A:) 3-phosphoinositide dependent protein kinase-1

SCOPe Domain Sequences for d1w1da1:

Sequence; same for both SEQRES and ATOM records:

>d1w1da1 b.55.1.1 (A:409-550) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}
gsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkg
lfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdp
sgnahkwcrkiqevwrqryqsh

Timeline for d1w1da1:

• d1w1da1 first appeared in SCOP 1.71, called d1w1da_
  
• d1w1da1 appears in SCOPe 2.07