Lineage for d1w0cg_ (1w0c G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450115Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2450118Species Leishmania major [TaxId:5664] [63926] (14 PDB entries)
    Uniprot Q01782
  8. 2450170Domain d1w0cg_: 1w0c G: [114058]
    complexed with nap, taq

Details for d1w0cg_

PDB Entry: 1w0c (more details), 2.6 Å

PDB Description: inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.
PDB Compounds: (G:) pteridine reductase

SCOPe Domain Sequences for d1w0cg_:

Sequence, based on SEQRES records: (download)

>d1w0cg_ c.2.1.2 (G:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedg
hepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtn
qpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrskv
plyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d1w0cg_ c.2.1.2 (G:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndreametatad
lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
gltrsaalelaplqirvngvgpglsvlvddmppeghrskvplyqrdssaaevsdvviflc
sskakyitgtcvkvdggysltra

SCOPe Domain Coordinates for d1w0cg_:

Click to download the PDB-style file with coordinates for d1w0cg_.
(The format of our PDB-style files is described here.)

Timeline for d1w0cg_: