Lineage for d1w07b2 (1w07 B:462-659)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321545Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2321664Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins)
    duplication: tandem repeat of this fold
  6. 2321665Protein Acyl-coenzyme A oxidase 1, domains 3 and 4 [116885] (1 species)
  7. 2321666Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116886] (1 PDB entry)
    Uniprot O65202
  8. 2321670Domain d1w07b2: 1w07 B:462-659 [114050]
    Other proteins in same PDB: d1w07a3, d1w07b3
    complexed with ca, cl, fad, pt

Details for d1w07b2

PDB Entry: 1w07 (more details), 2 Å

PDB Description: arabidopsis thaliana acyl-coa oxidase 1
PDB Compounds: (B:) acyl-CoA oxidase

SCOPe Domain Sequences for d1w07b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w07b2 a.29.3.2 (B:462-659) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ahllqcrsgvqkaedwlnpdvvleafearalrmavtcaknlskfenqeqgfqelladlve
aaiahcqlivvskfiakleqdiggkgvkkqlnnlcyiyalyllhkhlgdflstncitpkq
aslandqlrslytqvrpnavalvdafnytdhylnsvlgrydgnvypklfeealkdplnds
vvpdgyqeylrpvlqqql

SCOPe Domain Coordinates for d1w07b2:

Click to download the PDB-style file with coordinates for d1w07b2.
(The format of our PDB-style files is described here.)

Timeline for d1w07b2: