SCOPe 2.07: Domain d1vqwa2: 1vqw A:181-287

Lineage for d1vqwa2 (1vqw A:181-287)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Flavin-dependent monoxygenase SPBP16F5.08c [117444] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [117445] (3 PDB entries)
   Uniprot Q9HFE4

8. Domain d1vqwa2: 1vqw A:181-287 [114029]
   Structural genomics target
   complexed with epe, fad

Details for d1vqwa2

PDB Entry: 1vqw, 2.4 Å

PDB Description: crystal structure of a protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases

PDB Compounds: (A:) protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases

SCOPe Domain Sequences for d1vqwa2:

Sequence; same for both SEQRES and ATOM records:

>d1vqwa2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyc

Timeline for d1vqwa2:

• d1vqwa2 first appeared in SCOP 1.71
  
• d1vqwa2 appears in SCOPe 2.06
  
• d1vqwa2 appears in the current release, SCOPe 2.08