SCOP 1.71: Domain d1vpda2: 1vpd A:3-163

Lineage for d1vpda2 (1vpd A:3-163)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Hydroxyisobutyrate dehydrogenase [102171] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [110431] (1 PDB entry)

8. Domain d1vpda2: 1vpd A:3-163 [113952]
   Other proteins in same PDB: d1vpda1
   Structural genomics target
   complexed with cl, tla

Details for d1vpda2

PDB Entry: 1vpd, 1.65 Å

PDB Description: X-Ray Crystal Structure of Tartronate Semialdehyde Reductase [Salmonella Typhimurium LT2]

SCOP Domain Sequences for d1vpda2:

Sequence; same for both SEQRES and ATOM records:

>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium}
mkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdvi
itmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapv
sggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtg

Timeline for d1vpda2:

• d1vpda2 is new in SCOP 1.71
  
• d1vpda2 appears in SCOP 1.73
  
• d1vpda2 appears in the current release, SCOPe 2.08