SCOPe 2.08: Domain d1voyp_: 1voy P:

Lineage for d1voyp_ (1voy P:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1voyp_: 1voy P: [113872]
   Other proteins in same PDB: d1voy72
   50S subunit; the coordinates of 30S subunit in a different PDB entry
   protein/RNA complex
   protein/RNA complex

Details for d1voyp_

PDB Entry: 1voy, 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

PDB Compounds: (P:) 50S ribosomal protein L18

SCOPe Domain Sequences for d1voyp_:

Sequence; same for both SEQRES and ATOM records:

>d1voyp_ i.1.1.1 (P:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf

Timeline for d1voyp_:

• d1voyp_ first appeared in SCOP 1.71
  
• d1voyp_ appears in SCOPe 2.07