![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein 70S ribosome functional complex [58121] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
![]() | Domain d1voyy_: 1voy Y: [113881] Other proteins in same PDB: d1voy72 50S subunit; the coordinates of 30S subunit in a different PDB entry protein/RNA complex protein/RNA complex |
PDB Entry: 1voy (more details), 11.5 Å
SCOPe Domain Sequences for d1voyy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1voyy_ i.1.1.1 (Y:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela rkgeq
Timeline for d1voyy_:
![]() Domains from other chains: (mouse over for more information) d1voy1_, d1voy2_, d1voy3_, d1voy4_, d1voy5_, d1voy6_, d1voy71, d1voy72, d1voyd_, d1voye_, d1voyf_, d1voyg_, d1voyh_, d1voyi_, d1voyj_, d1voyk_, d1voyl_, d1voym_, d1voyn_, d1voyo_, d1voyp_, d1voyq_, d1voyr_, d1voys_, d1voyt_, d1voyu_, d1voyv_, d1voyw_, d1voyx_, d1voyz_ |