SCOP 1.71: Domain d1v9oa_: 1v9o A:

Lineage for d1v9oa_ (1v9o A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)

6. Protein PII (product of glnB) [54915] (5 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)

8. Domain d1v9oa_: 1v9o A: [113595]

Details for d1v9oa_

PDB Entry: 1v9o, 2 Å

PDB Description: Crystal structure of TT1020 from Thermus thermophilus HB8

SCOP Domain Sequences for d1v9oa_:

Sequence, based on SEQRES records:

>d1v9oa_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedea

Sequence, based on observed residues (ATOM records):

>d1v9oa_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetelhekvrleigvsepfvkpt
veailkaartgevgdgkifvlpvekvyrirtgeedea

Timeline for d1v9oa_:

• d1v9oa_ is new in SCOP 1.71
  
• d1v9oa_ appears in SCOP 1.73
  
• d1v9oa_ appears in the current release, SCOPe 2.08