![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (4 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins) |
![]() | Protein PII (product of glnB) [54915] (5 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
![]() | Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries) |
![]() | Domain d1v9oa_: 1v9o A: [113595] |
PDB Entry: 1v9o (more details), 2 Å
SCOP Domain Sequences for d1v9oa_:
Sequence, based on SEQRES records: (download)
>d1v9oa_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus} mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedea
>d1v9oa_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus} mklivaivrpeklnevlkalfqaevrgltlsrvqghggetelhekvrleigvsepfvkpt veailkaartgevgdgkifvlpvekvyrirtgeedea
Timeline for d1v9oa_: