PDB entry 1v9o

View 1v9o on RCSB PDB site
Description: Crystal structure of TT1020 from Thermus thermophilus HB8
Deposited on 2004-01-27, released 2005-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v9oa_
  • Chain 'B':
    Domains in SCOP 1.71: d1v9ob_
  • Chain 'C':
    Domains in SCOP 1.71: d1v9oc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9oA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9oA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetelhekvrleigvsepfvkpt
    veailkaartgevgdgkifvlpvekvyrirtgeedea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v9oB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9oB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghgmelhekvrleigvsepfvkptve
    ailkaartgevgdgkifvlpvekvyrirtgeed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v9oC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9oC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghlhekvrleigvsepfvkptveail
    kaartgevgdgkifvlpvekvyrirtgeed