Lineage for d1v8bc2 (1v8b C:4-234,C:398-479)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1159281Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 1159388Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 1159389Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 1159431Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117480] (1 PDB entry)
    Uniprot P50250
  8. 1159434Domain d1v8bc2: 1v8b C:4-234,C:398-479 [113569]
    Other proteins in same PDB: d1v8ba1, d1v8bb1, d1v8bc1, d1v8bd1
    complexed with adn, nad

Details for d1v8bc2

PDB Entry: 1v8b (more details), 2.4 Å

PDB Description: Crystal structure of a hydrolase
PDB Compounds: (C:) Adenosylhomocysteinase

SCOPe Domain Sequences for d1v8bc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8bc2 c.23.12.3 (C:4-234,C:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}
nkskvkdislapfgkmqmeisenempglmrireeygkdqplknakitgclhmtvecalli
etlqklgaqirwcscniystadyaaaavstlenvtvfawknetleeywwcvesaltwgdg
ddngpdmivddggdatllvhkgveyeklyeeknilpdpekakneeercfltllknsilkn
pkkwtniakkiigvseetttgvlrlkkmdkqnellftainvndavtkqkydXhpafvmsf
sfcnqtfaqldlwqnkdtnkyenkvyllpkhldekvalyhlkklnasltelddnqcqflg
vnksgpfksneyry

SCOPe Domain Coordinates for d1v8bc2:

Click to download the PDB-style file with coordinates for d1v8bc2.
(The format of our PDB-style files is described here.)

Timeline for d1v8bc2: