Lineage for d1v7aa_ (1v7a A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971606Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. 971607Protein Adenosine deaminase (ADA) [51558] (3 species)
    Common fold covers the whole protein structure
  7. 971608Species Cow (Bos taurus) [TaxId:9913] [82257] (12 PDB entries)
    Uniprot P56658 3-350 ! Uniprot P56658
  8. 971617Domain d1v7aa_: 1v7a A: [113560]
    complexed with frc, zn

Details for d1v7aa_

PDB Entry: 1v7a (more details), 2.5 Å

PDB Description: Crystal structures of adenosine deaminase complexed with potent inhibitors
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d1v7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7aa_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOPe Domain Coordinates for d1v7aa_:

Click to download the PDB-style file with coordinates for d1v7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1v7aa_: